PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00016.1_g00127.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 337aa    MW: 37741.4 Da    PI: 6.6316
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00016.1_g00127.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.91.3e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT++Ede+lv++vk++G  +W++ ++  g++R++k+c++rw +yl
  Rsa1.0_00016.1_g00127.1 14 KGPWTPDEDEKLVKYVKKHGHSSWSALPKLAGLNRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding50.64.4e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++++E++ ++++++  G++ W+tIa+ ++ gRt++++k++w+++l
  Rsa1.0_00016.1_g00127.1  67 RGKFSPDEEQTILNLHAVVGNK-WSTIANNLP-GRTDNEIKNFWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.545961IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-25964IPR009057Homeodomain-like
SuperFamilySSF466894.4E-3111108IPR009057Homeodomain-like
SMARTSM007176.0E-161363IPR001005SANT/Myb domain
PfamPF002496.3E-181461IPR001005SANT/Myb domain
CDDcd001675.59E-131661No hitNo description
PROSITE profilePS5129425.95962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-2765117IPR009057Homeodomain-like
SMARTSM007174.5E-1566114IPR001005SANT/Myb domain
PfamPF002499.7E-1567112IPR001005SANT/Myb domain
CDDcd001672.91E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRPPSGDDS SLKKGPWTPD EDEKLVKYVK KHGHSSWSAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SPDEEQTILN LHAVVGNKWS TIANNLPGRT DNEIKNFWNT HLKKKLIQMG  120
VDPMTHRPRT DVLSGLSQLI SLSSDLRGFV DLQQQFPVNQ EQTILKLQTE MAKLQLFQYL  180
LQPPSMYNNI NPNDVDTLSL LNSIASFKDT TTSKNLDLSS YIQEFNTLPS LKSLNANIGP  240
SSVSPQNPVE NHFKFFNQRE NLLISPSWLS DPSSSNQSLL PSLDPSSALT DDLIRSQYVI  300
EDVNSNLTSS SCQESAASAS AAWPDHLLDD SIFFDIP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399522.10.0hypothetical protein EUTSA_v10014028mg
SwissprotQ8GWP02e-68MYB39_ARATH; Transcription factor MYB39
TrEMBLV4KSR40.0V4KSR4_EUTSA; Uncharacterized protein
STRINGBra028593.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-163myb domain protein 92